PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G021900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 687aa    MW: 74079.7 Da    PI: 10.7794
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G021900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.81.8e-084204571954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps  ++  L++++gL+ +qV++WF N R +
  Brast02G021900.1.p 420 FEHflHPYPSDVDKHILSRQTGLSRSQVSNWFINARVR 457
                         554459******************************88 PP

2BELL83.92e-27278346472
                BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         elq+ k kL  +leeVd+rY++y+eq++ +++ Feavag  +a+ Yt+lA+++iSrhFr+L+d ++ q+
  Brast02G021900.1.p 278 ELQRLKDKLYIMLEEVDRRYRRYCEQMRGLAGGFEAVAGERAAAGYTALASRTISRHFRSLRDGVVAQL 346
                         89999*************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.6E-25213344IPR006563POX domain
PfamPF075265.0E-32237342IPR006563POX domain
PROSITE profilePS5007111.629398461IPR001356Homeobox domain
SMARTSM003891.6E-8401465IPR001356Homeobox domain
CDDcd000863.36E-11401462No hitNo description
SuperFamilySSF466891.11E-16402468IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-27404467IPR009057Homeodomain-like
PfamPF059202.6E-17418457IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 687 aa     Download sequence    Send to blast
MDTLLASSTS PDIYVGTKAT AGGRPGAKLL ETQQQQQQQQ RQGEAKARRQ PPPADGRRAQ  60
AIAHSHQLFG SSWTCWRFER GGYRWRMIRV SGSRTTYRLP TRRPRRRSCR PWTTGRLRSS  120
TACRQAWSCS ACTPPCRARR RLPPLLTATD QGTPASPPCA SSSSSSSIRI SRRRCPSRCN  180
TTSSSSTRRC RHGWCTSRTR PRTGMARRGT FAAPGSCSRR SSCWKGSAAS PWTPKPSAQR  240
QQRSSSKKMP AGGGGEGSSS SSSCRAPSAQ IQAMDALELQ RLKDKLYIML EEVDRRYRRY  300
CEQMRGLAGG FEAVAGERAA AGYTALASRT ISRHFRSLRD GVVAQLQAVR KALGEKDSSS  360
SKSPGGMTRG DTPRLKVLDQ CIRQHKAMHQ NGGLLMETHP WRPQRGLPER AVTVLRAWLF  420
EHFLHPYPSD VDKHILSRQT GLSRSQVSNW FINARVRLWK PMVEEMYVEE MKDDGGAQGH  480
EGQVVVDASA ANNNPSSGSN QLVQGDGGEQ KPTRAQLRHA DADADIGVAA HGRHDAGSLA  540
SVVNVGRMGM ESFADMDGHG HFGFDAYDTA DADAGPSAGF GGGGGVSLTL GLQQHDSRGD  600
HGGVNIAFGA PGPAHGGYLF PGDHQQQMGM LHTSAGHGHH IQFGAGGGMA DSSAGDASNG  660
AGHVDAQQYR WLSAAGSSSL LRDMTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16407464158Homeobox protein Meis1
4xrs_B2e-16407464158Homeobox protein Meis1
5bng_A3e-16407465159Homeobox protein Meis2
5bng_B3e-16407465159Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101106RRPRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752259.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010229286.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_003562164.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLI1HAB90.0I1HAB9_BRADI; Uncharacterized protein
STRINGBRADI1G76940.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38143764
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.22e-80BEL1-like homeodomain 2